PEMBUATAN GELATIN DARI CAMPURAN KULIT IKAN GABUS DAN α KASEIN DENGAN METODE EKSTRASI VARIASI WAKTU PERENDAMAN DAN PELARUT

SASMITO, CAHYO (2020) PEMBUATAN GELATIN DARI CAMPURAN KULIT IKAN GABUS DAN α KASEIN DENGAN METODE EKSTRASI VARIASI WAKTU PERENDAMAN DAN PELARUT. Other thesis, POLITEKNIK NEGERI SRIWIJAYA.

[img] Text (Cover)
file 1.pdf

Download (657kB)
[img] Text (Bab 1)
file 2.pdf

Download (126kB)
[img] Text (Bab 2)
file 3.pdf

Download (489kB)
[img] Text (Bab 3)
file 4.pdf
Restricted to Repository staff only

Download (617kB)
[img] Text (Bab 4)
file 5.pdf
Restricted to Repository staff only

Download (486kB)
[img] Text (Bab 5)
file 6.pdf

Download (285kB)
[img] Text (Daftar Pustaka)
file 7.pdf

Download (130kB)

Abstract

CahyoSasmito, 2020, 68Halaman, Tabel, Gambar, 4 Lampiran Di Sumatera Selatan ikangabusdimanfaatkanolehindustrikerupuk, kemplangdanpempek. Padaikangabus, 30% nyamerupakanlimbahberupakulitdantulang. Potensikulitikangabussebagaisumberalternatifkolagendapatmenjadisolusidalampembuatangelatin yang amanuntukkalanganmasyarakat. Penelitianinibertujuanuntukmenentukanpengaruhvariasiterhadapkualitasdandapatkankondisi optimal untukpembuatangelatinberdasarkanvariasiwaktuperendamandanvariasipelarut. Metodepadapenelitianinidilakukandengantigatahapanyaknitahapanawalpembuatangelatindenganekstraksi, tahapankeduapembuatancasein darisususapimurni, dantahapanterakhirpencampurangelatindengancasein. Padatahapawaldigunakan proses perlakuanberbedadenganvariasirasiowaktuperendamanyaitu 12, 24, 36, dan 48 jam, sertavariasipelarutHCldan H2SO4. Hasilanalisadiamatiadalahrendemen,organoleptik, kadar air, kadarabu, pH, kekuatan gel, viskositasdankadar protein. Hasilpenelitianmenunjukkanbahwagelatin yang telahdicampurkaseindaripenelitianmenghasilkankadar air 4,28-12,90 %, kadarabu 1,77-9,27% pH 5,5-4, viskositas 12,58-15,72 cPs, kadar protein 53,27 – 86,18 % dankekuatan gel 217,57499,13 bloom sertahasilpengujianorganoleptikberupawarnakuningpucat,kremdanabumuda. Hasildaripenelitiankondisi optimum dariinteraksivariabel yang digunakanuntukmembuatgelatinyaitupadaanalisaviskositasphdankekuatan gel adalahwaktu 48 jam danpelarutHCluntukviskositaspelarut yang optimum adalah H2SO4 sedangkananalisakadarabu, kadar air, rendemendan protein waktuperendamannya 36 jam denganpelarutHCluntuk protein dankadarabupelarut yang optimum adalah H2SO4

Item Type: Thesis (Other)
Uncontrolled Keywords: Kata kunci:Gelatin, KulitIkanGabus, Casein, waktuperendaman
Subjects: T Technology > TP Chemical technology
Divisions: Chemical Engineering > Undergraduate Theses
Depositing User: Mr Bambang Anthony
Date Deposited: 14 Sep 2021 00:39
Last Modified: 14 Sep 2021 00:39
URI: http://eprints.polsri.ac.id/id/eprint/9491

Actions (login required)

View Item View Item