PEMBUATAN TEPUNG SERAT TINGGI DARI AMPAS KELAPA DENGAN METODE PENGERINGAN BEKU VAKUM

PUTRI, SHANIA (2020) PEMBUATAN TEPUNG SERAT TINGGI DARI AMPAS KELAPA DENGAN METODE PENGERINGAN BEKU VAKUM. Other thesis, POLITEKNIK NEGERI SRIWIJAYA.

[img] Text (Cover)
File I.pdf

Download (571kB)
[img] Text (Bab 1)
File II.pdf

Download (108kB)
[img] Text (Bab 2)
File III.pdf

Download (558kB)
[img] Text (Bab 3)
File IV.pdf
Restricted to Repository staff only

Download (215kB)
[img] Text (Bab 4)
File V.pdf
Restricted to Repository staff only

Download (208kB)
[img] Text (Bab 5)
File VI.pdf

Download (81kB)
[img] Text (Daftar P ustaka)
File VII.pdf

Download (265kB)

Abstract

SHANIA PUTRI. PembuatanTepungSerat Tinggi dariAmpasKelapadenganMetodePengeringanBekuVakum. Di bawahbimbinganINDAH PURNAMASARI, S.T., M.Eng. dan Ir. MUSTAIN ZAMHARI, M.Si. Tanamankelapamerupakantanamanserbagunaatautanaman yang mempunyainilaiekonomitinggi. Pohon kelapaseringdisebutsebagaipohonkehidupan(tree of life)karenahampirseluruhdaribagianpohon, akar, batang, daundanbuahnyadapatdipergunakanuntukkebutuhankehidupanmanusiasehari-hari.Ampaskelapamerupakanhasilsampingdaripembuatansantan. Kelapamerupakansalahsatuproduktanamantropis yang unikkarenakomponendaridagingbuahnyadapatlangsungdikonsumsi, danjugakomponen air buahnyadapatlangsungdiminumtanpamelalui proses pengolahan, sehinggaprodukinisangatdigemariolehanak-anakmaupun orang dewasa. Buahkelapa yang menjadibahanbakuminyakdisebut ‘’Kopra’’, Dimanakandunganminyaknyaberkisarantara 60 – 65 %. Sedangkandagingbuahsegar yang masihmudakandunganminyaknyasekitar 43 %. Dahuluampaskelapahanyadimanfaatkansebagaipakanternakdantempebongkrek, padahaldengan modal yang relatifkecilampaskelapadapatdiolahmenjadiproduklainnyasepertitepung. Tepungampaskelapadibuatsecaralangsungdarihasilsampingampaskelapa. Ampaskelapakeringataubebaslemakmengandung 93% karbohidrat yang terdiridari 61% galaktomanan, 26% manosadan 13% selulosa. Tepungampaskelapainidapatdimanfaatkansebagaibahanbakudalamindustrimakananseperti roti, biskuit, dansereal. Roti merupakanmakanan yang dapatditerimaolehsemualapisanmasyarakatkarenapraktis, mudahdidapatkan, mudahdiolah, mudahdisajikandanmemilikihargaygrelatifterjangkau.Tujuandaripenelitianiniadalahmenentukantemperatur yang terbaikdalampembuatantepungampaskelapadenganmetodepengeringanvakumbeku(Vacuum Freeze Drying). PengeringanampaskelapadenganmenggunakanalatVacuum Freeze Drying dilakukandenganbeberapavariasitemperatur, yaitu -8 °C, -10 °C, -12 °C, -14 °C danvariasiberatampaskelapa 100 dan 200 gram, sertavariabeltetapdenganmenggunakanwaktupengeringan primer 6 jam, pengeringansekunder 4 jam. Padapenentuanmutuampaskelapaberdasarkankandungangiziseratkasar, protein, lemakdankadar air yang terdapatdidalamproduk, yaitumelaluianalisadenganmetodeKjedahldanSoxhlet.

Item Type: Thesis (Other)
Uncontrolled Keywords: Kata kunci: Ampaskelapa, Tepung, Vacuum Freeze Drying.
Subjects: T Technology > TP Chemical technology
Divisions: Chemical Engineering > Undergraduate Theses
Depositing User: Mr Bambang Anthony
Date Deposited: 13 Sep 2021 01:15
Last Modified: 13 Sep 2021 01:15
URI: http://eprints.polsri.ac.id/id/eprint/9401

Actions (login required)

View Item View Item